General Information

  • ID:  hor005714
  • Uniprot ID:  Q9PTA0
  • Protein name:  Neuropeptide Y
  • Gene name:  npy
  • Organism:  Dicentrarchus labrax (European seabass) (Morone labrax)
  • Family:  NPY Family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Dicentrarchus (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031841 neuropeptide Y receptor binding; GO:0031843 type 2 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045938 positive regulation of circadian sleep/wake cycle, sleep; GO:0071878 negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway; GO:2000253 positive regulation of feeding behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPVKPENPGEDAPAEELAKYYSALRHYINLITRQRY
  • Length:  36
  • Propeptide:  MHPNLVSWLGTLGFLLWALLCLGALTEGYPVKPENPGEDAPAEELAKYYSALRHYINLITRQRYGKRSSPEILDTLVSELLLKESTDQLPQSRYDPSLW
  • Signal peptide:  MHPNLVSWLGTLGFLLWALLCLGALTEG
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PTA0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005714_AF2.pdbhor005714_ESM.pdb

Physical Information

Mass: 489124 Formula: C194H294N52O57
Absent amino acids: CFMW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: -98.61 Boman Index: -8515
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 73.33
Instability Index: 7223.33 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  NA
  • Title:  NA