HORDB

ID: hor005714
Uniprot ID: Q9PTA0
Protein name: Neuropeptide Y
Gene name: npy
Organism: Dicentrarchus labrax (European seabass) (Morone labrax)
Family: NPY Family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Dicentrarchus (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031841 neuropeptide Y receptor binding; GO:0031843 type 2 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0045938 positive regulation of circadian sleep/wake cycle, sleep; GO:0071878 negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway; GO:2000253 positive regulation of feeding behavior
GO CC: GO:0005576 extracellular region

Sequence: YPVKPENPGEDAPAEELAKYYSALRHYINLITRQRY
Length: 36
Propeptide: MHPNLVSWLGTLGFLLWALLCLGALTEGYPVKPENPGEDAPAEELAKYYSALRHYINLITRQRYGKRSSPEILDTLVSELLLKESTDQLPQSRYDPSLW
Signal peptide: MHPNLVSWLGTLGFLLWALLCLGALTEG
Modification: T36 Tyrosine amide
Glycosylation: NA
Mutagenesis: NA

Function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005714_AF2.pdb

hor005714_ESM.pdb

Mass:	489124	Formula:	C194H294N52O57
Absent amino acids:	CFMW	Common amino acids:	Y
pI:	7.52	Basic residues:	6
Polar residues:	10	Hydrophobic residues:	10
Hydrophobicity:	-98.61	Boman Index:	-8515
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	73.33
Instability Index:	7223.33	Extinction Coefficient cystines:	7450
Absorbance 280nm:	212.86